Lineage for d3k8ca_ (3k8c A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2169121Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold
  4. 2169122Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) (S)
  5. 2169174Family c.121.1.0: automated matches [191649] (1 protein)
    not a true family
  6. 2169175Protein automated matches [191196] (8 species)
    not a true protein
  7. 2169214Species Trypanosoma cruzi [TaxId:353153] [189510] (4 PDB entries)
  8. 2169223Domain d3k8ca_: 3k8c A: [179181]
    automated match to d1nn4b_
    complexed with res

Details for d3k8ca_

PDB Entry: 3k8c (more details), 2.1 Å

PDB Description: Complex of Trypanosoma cruzi ribose 5-phosphate isomerase type B with 4-deoxy-4-phospho-D-erythronohydroxamic acid
PDB Compounds: (A:) Ribose 5-phosphate isomerase

SCOPe Domain Sequences for d3k8ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k8ca_ c.121.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 353153]}
mtrrvaigtdhpafaihenlilyvkeagdefvpvycgpktaesvdypdfasrvaemvark
evefgvlacgsgigmsiaankvpgvraalchdhytaamsrihndanivcvgerttgvevi
reiiitflqtpfsgeerhvrriekiraieash

SCOPe Domain Coordinates for d3k8ca_:

Click to download the PDB-style file with coordinates for d3k8ca_.
(The format of our PDB-style files is described here.)

Timeline for d3k8ca_: