Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) |
Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins) |
Protein Dihydrofolate reductase, prokaryotic type [53599] (8 species) |
Species Escherichia coli K-12 [TaxId:83333] [187149] (6 PDB entries) |
Domain d3k74a_: 3k74 A: [179137] Other proteins in same PDB: d3k74b_ automated match to d1ddra_ |
PDB Entry: 3k74 (more details), 1.95 Å
SCOPe Domain Sequences for d3k74a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k74a_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Escherichia coli K-12 [TaxId: 83333]} misliaalavdrvigmenampwnlpadlawfkrntlnkpvimgrhtwesigrplpgrkni ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve gdthfpdyepddwesvfsefhdadaqnshsycfeilerr
Timeline for d3k74a_: