Lineage for d3k6pa1 (3k6p A:289-518)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011944Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2011945Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2011946Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2012913Protein automated matches [190059] (14 species)
    not a true protein
  7. 2012935Species Human (Homo sapiens) [TaxId:9606] [187214] (173 PDB entries)
  8. 2012998Domain d3k6pa1: 3k6p A:289-518 [179135]
    Other proteins in same PDB: d3k6pa2
    automated match to d1xb7a_
    protein/DNA complex; complexed with 5fb

Details for d3k6pa1

PDB Entry: 3k6p (more details), 2 Å

PDB Description: estrogen related receptor alpha in complex with an ether based ligand
PDB Compounds: (A:) Steroid hormone receptor ERR1

SCOPe Domain Sequences for d3k6pa1:

Sequence, based on SEQRES records: (download)

>d3k6pa1 a.123.1.1 (A:289-518) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvnalvshllvvepeklyampdpagpdghlpavatlcdlfdreivvtiswaksipgfssl
slsdqmsvlqsvwmevlvlgvaqrslplqdelafaedlvldeegaraaglgelgaallql
vrrlqalrlereeyvllkalalansdsvhiedaeaveqlrealhealleyeagragpggg
aerrragrllltlpllrqtagkvlahfygvklegkvpmhklflemleamm

Sequence, based on observed residues (ATOM records): (download)

>d3k6pa1 a.123.1.1 (A:289-518) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvnalvshllvvepeklyamphlpavatlcdlfdreivvtiswaksipgfsslslsdqms
vlqsvwmevlvlgvaqrslplqdelafaedlvldeegaraaglgelgaallqlvrrlqal
rlereeyvllkalalansdsvhiedaeaveqlrealhealleyeagrggaerragrlllt
lpllrqtagkvlahfygvlegkvpmhklflemleamm

SCOPe Domain Coordinates for d3k6pa1:

Click to download the PDB-style file with coordinates for d3k6pa1.
(The format of our PDB-style files is described here.)

Timeline for d3k6pa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3k6pa2