Lineage for d1qj2a1 (1qj2 A:82-161)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 48597Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
  4. 48598Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (1 family) (S)
  5. 48599Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (3 proteins)
  6. 48605Protein Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain [47748] (2 species)
  7. 48611Species Pseudomonas carboxydovorans [47749] (1 PDB entry)
  8. 48612Domain d1qj2a1: 1qj2 A:82-161 [17913]
    Other proteins in same PDB: d1qj2a2, d1qj2b1, d1qj2b2, d1qj2c1, d1qj2c2, d1qj2g2, d1qj2h1, d1qj2h2, d1qj2i1, d1qj2i2

Details for d1qj2a1

PDB Entry: 1qj2 (more details), 2.2 Å

PDB Description: co dehydrogenase from oligotropha carboxidovorans

SCOP Domain Sequences for d1qj2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qj2a1 a.56.1.1 (A:82-161) Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain {Pseudomonas carboxydovorans}
apdgtlsalqegfrmmhglqcgyctpgmimrshrllqenpspteaeirfgiggnlcrctg
yqnivkaiqyaaakingvpf

SCOP Domain Coordinates for d1qj2a1:

Click to download the PDB-style file with coordinates for d1qj2a1.
(The format of our PDB-style files is described here.)

Timeline for d1qj2a1: