Class a: All alpha proteins [46456] (284 folds) |
Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily) core: 4 helices, bundle |
Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (1 family) contains 2Fe-2S cluster |
Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (6 proteins) |
Protein Xanthine oxidase, domain 2 [47746] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [47747] (6 PDB entries) Uniprot P80457 |
Domain d1fiqa1: 1fiq A:93-165 [17912] Other proteins in same PDB: d1fiqa2, d1fiqb1, d1fiqb2, d1fiqc1, d1fiqc2 complexed with fad, fes, gol, mos, mte, sal |
PDB Entry: 1fiq (more details), 2.5 Å
SCOP Domain Sequences for d1fiqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fiqa1 a.56.1.1 (A:93-165) Xanthine oxidase, domain 2 {Cow (Bos taurus) [TaxId: 9913]} stktrlhpvqeriakshgsqcgfctpgivmsmytllrnqpeptveeiedafqgnlcrctg yrpilqgfrtfak
Timeline for d1fiqa1:
View in 3D Domains from other chains: (mouse over for more information) d1fiqb1, d1fiqb2, d1fiqc1, d1fiqc2 |