Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (19 species) not a true protein |
Species Lactobacillus plantarum [TaxId:1590] [189101] (1 PDB entry) |
Domain d3k69a_: 3k69 A: [179112] automated match to d1ylfa1 complexed with dms |
PDB Entry: 3k69 (more details), 1.95 Å
SCOPe Domain Sequences for d3k69a_:
Sequence, based on SEQRES records: (download)
>d3k69a_ a.4.5.0 (A:) automated matches {Lactobacillus plantarum [TaxId: 1590]} mkldfsvavhsilyldahrdskvasrelaqslhlnpvmirnilsvlhkhgyltgtvgkng gyqldlaladmnlgdlydltipptisyarfitgpsktdeqadqspiaanisetltdlftv adrqyrayyhqftmadlqadlnhhgtflqheqdse
>d3k69a_ a.4.5.0 (A:) automated matches {Lactobacillus plantarum [TaxId: 1590]} mkldfsvavhsilyldahrdskvasrelaqslhlnpvmirnilsvlhkhgyltgtvgkng gyqldlaladmnlgdlydltipptisyarfitgpskadqspiaanisetltdlftvadrq yrayyhqftmadlqadlnhhgtflqheqdse
Timeline for d3k69a_: