SCOP 1.69: Domain d1fo4b1: 1fo4 B:93-165

Lineage for d1fo4b1 (1fo4 B:93-165)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
   core: 4 helices, bundle

4. Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (1 family)
   contains 2Fe-2S cluster

5. Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (5 proteins)

6. Protein Xanthine oxidase, domain 2 [47746] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47747] (4 PDB entries)

8. Domain d1fo4b1: 1fo4 B:93-165 [17911]
   Other proteins in same PDB: d1fo4a2, d1fo4a3, d1fo4a4, d1fo4a5, d1fo4a6, d1fo4b2, d1fo4b3, d1fo4b4, d1fo4b5, d1fo4b6

Details for d1fo4b1

PDB Entry: 1fo4, 2.1 Å

PDB Description: crystal structure of xanthine dehydrogenase isolated from bovine milk

SCOP Domain Sequences for d1fo4b1:

Sequence; same for both SEQRES and ATOM records:

>d1fo4b1 a.56.1.1 (B:93-165) Xanthine oxidase, domain 2 {Cow (Bos taurus)}
stktrlhpvqeriakshgsqcgfctpgivmsmytllrnqpeptveeiedafqgnlcrctg
yrpilqgfrtfak

Timeline for d1fo4b1:

• d1fo4b1 first appeared (with stable ids) in SCOP 1.55
  
• d1fo4b1 appears in SCOP 1.67
  
• d1fo4b1 appears in SCOP 1.71
  
• d1fo4b1 appears in the current release, SCOPe 2.08