Lineage for d3k4ga_ (3k4g A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328564Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2328899Superfamily a.60.3: C-terminal domain of RNA polymerase alpha subunit [47789] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 2328900Family a.60.3.1: C-terminal domain of RNA polymerase alpha subunit [47790] (2 proteins)
  6. 2328912Protein automated matches [191020] (3 species)
    not a true protein
  7. 2328918Species Escherichia coli K-12 [TaxId:83333] [189388] (2 PDB entries)
  8. 2328919Domain d3k4ga_: 3k4g A: [179067]
    automated match to d1cooa_
    complexed with na

Details for d3k4ga_

PDB Entry: 3k4g (more details), 2.05 Å

PDB Description: Crystal structure of E. coli RNA polymerase alpha subunit C-terminal domain
PDB Compounds: (A:) DNA-directed RNA polymerase subunit alpha

SCOPe Domain Sequences for d3k4ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k4ga_ a.60.3.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
kpefdpillrpvddleltvrsanclkaeaihyigdlvqrtevellktpnlgkkslteikd
vlasrglslgmrlenwppasiade

SCOPe Domain Coordinates for d3k4ga_:

Click to download the PDB-style file with coordinates for d3k4ga_.
(The format of our PDB-style files is described here.)

Timeline for d3k4ga_: