Lineage for d3k4fb_ (3k4f B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015324Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2015325Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2015326Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
    automatically mapped to Pfam PF01126
  6. 2015372Protein Heme oxygenase-1 (HO-1) [48615] (3 species)
  7. 2015373Species Human (Homo sapiens) [TaxId:9606] [48616] (25 PDB entries)
    Uniprot P09601
  8. 2015393Domain d3k4fb_: 3k4f B: [179066]
    automated match to d1ni6c_
    complexed with hem, hez, q86, so4

Details for d3k4fb_

PDB Entry: 3k4f (more details), 2.17 Å

PDB Description: X-Ray Crystal Structure of Human Heme Oxygenase-1 in Complex with 4-Phenyl-1-(1H-1,2,4-triazol-1-yl)-2-butanone
PDB Compounds: (B:) Heme oxygenase 1

SCOPe Domain Sequences for d3k4fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k4fb_ a.132.1.1 (B:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
emtpavrqrvieeaktafllniqlfeelqellth

SCOPe Domain Coordinates for d3k4fb_:

Click to download the PDB-style file with coordinates for d3k4fb_.
(The format of our PDB-style files is described here.)

Timeline for d3k4fb_: