SCOPe 2.08: Domain d3k4fb_: 3k4f B:

Lineage for d3k4fb_ (3k4f B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
   automatically mapped to Pfam PF01126

6. Protein Heme oxygenase-1 (HO-1) [48615] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48616] (26 PDB entries)
   Uniprot P09601

8. Domain d3k4fb_: 3k4f B: [179066]
   automated match to d1ni6c_
   complexed with hem, hez, q86, so4

Details for d3k4fb_

PDB Entry: 3k4f, 2.17 Å

PDB Description: X-Ray Crystal Structure of Human Heme Oxygenase-1 in Complex with 4-Phenyl-1-(1H-1,2,4-triazol-1-yl)-2-butanone

PDB Compounds: (B:) Heme oxygenase 1

SCOPe Domain Sequences for d3k4fb_:

Sequence; same for both SEQRES and ATOM records:

>d3k4fb_ a.132.1.1 (B:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
emtpavrqrvieeaktafllniqlfeelqellth

Timeline for d3k4fb_:

• d3k4fb_ first appeared in SCOPe 2.01
  
• d3k4fb_ appears in SCOPe 2.07