Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (19 species) not a true protein |
Species Llama (Lama glama) [TaxId:9844] [189241] (5 PDB entries) |
Domain d3k3qa_: 3k3q A: [179047] automated match to d1ol0a_ complexed with zn |
PDB Entry: 3k3q (more details), 2.6 Å
SCOPe Domain Sequences for d3k3qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k3qa_ b.1.1.0 (A:) automated matches {Llama (Lama glama) [TaxId: 9844]} avqlvdsgggtlqagkslrlscaisglafdggamgsehrltagamgwfrqapgkdrefva aisprtdetyyaeslegrfsvsrdaaatmvflqadnvrlddtasyycaadedvtprvmgv iphadhwgqgtlvtvss
Timeline for d3k3qa_: