SCOPe 2.04: Domain d3k3qa_: 3k3q A:

Lineage for d3k3qa_ (3k3q A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [189241] (5 PDB entries)

8. Domain d3k3qa_: 3k3q A: [179047]
   automated match to d1ol0a_
   complexed with zn

Details for d3k3qa_

PDB Entry: 3k3q, 2.6 Å

PDB Description: crystal structure of a llama antibody complexed with the c. botulinum neurotoxin serotype a catalytic domain

PDB Compounds: (A:) llama Aa1 VHH domain

SCOPe Domain Sequences for d3k3qa_:

Sequence; same for both SEQRES and ATOM records:

>d3k3qa_ b.1.1.0 (A:) automated matches {Llama (Lama glama) [TaxId: 9844]}
avqlvdsgggtlqagkslrlscaisglafdggamgsehrltagamgwfrqapgkdrefva
aisprtdetyyaeslegrfsvsrdaaatmvflqadnvrlddtasyycaadedvtprvmgv
iphadhwgqgtlvtvss

Timeline for d3k3qa_:

• d3k3qa_ first appeared in SCOPe 2.01
  
• d3k3qa_ appears in SCOPe 2.03
  
• d3k3qa_ appears in SCOPe 2.05
  
• d3k3qa_ appears in the current release, SCOPe 2.08