SCOPe 2.08: Domain d3k3hb_: 3k3h B:

Lineage for d3k3hb_ (3k3h B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A [109942] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109943] (22 PDB entries)
   Uniprot O76083 241-566

8. Domain d3k3hb_: 3k3h B: [179041]
   automated match to d2hd1a1
   complexed with bye, mg, zn

Details for d3k3hb_

PDB Entry: 3k3h, 2.5 Å

PDB Description: Crystal structure of the PDE9A catalytic domain in complex with (S)-BAY73-6691

PDB Compounds: (B:) High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A

SCOPe Domain Sequences for d3k3hb_:

Sequence; same for both SEQRES and ATOM records:

>d3k3hb_ a.211.1.2 (B:) High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A {Human (Homo sapiens) [TaxId: 9606]}
yllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpvtlrrwlfcvhdn
yrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichdldhpgynntyqi
nartelavryndisplenhhcavafqilaepecnifsnippdgfkqirqgmitlilatdm
arhaeimdsfkekmenfdysneehmtllkmilikccdisnevrpmevaepwvdclleeyf
mqsdrekseglpvapfmdrdkvtkataqigfikfvlipmfetvtklfpmveeimlqplwe
srdryeelkriddamkelqkk

Timeline for d3k3hb_:

• d3k3hb_ first appeared in SCOPe 2.01
  
• d3k3hb_ appears in SCOPe 2.07