Lineage for d3k39l_ (3k39 L:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807606Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2807607Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2807608Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 2807621Protein Influenza neuraminidase [50943] (9 species)
  7. 2807786Species Influenza B virus [TaxId:11520] [50945] (20 PDB entries)
  8. 2807817Domain d3k39l_: 3k39 L: [179015]
    automated match to d1a4ga_
    complexed with bcz, ca, nag, yt3; mutant

Details for d3k39l_

PDB Entry: 3k39 (more details), 2.54 Å

PDB Description: crystal structure of b/perth neuraminidase d197e mutant in complex with peramivir
PDB Compounds: (L:) Neuraminidase

SCOPe Domain Sequences for d3k39l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k39l_ b.68.1.1 (L:) Influenza neuraminidase {Influenza B virus [TaxId: 11520]}
pewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpkeckhfalthyaa
qpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewtyigvdgpe
nnallkikygeaytdtyhsyannilrtqesacnciggncylmitdgsasgisecrflkir
egriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirlm
ctetyldtprpddgsitgpcesngdkgsggikggfvhqrmaskigrwysrtmsktkrmgm
glyvkydgdpwtdsdalalsgvmvsmeepgwysfgfeikdkkcdvpcigiemvhdggket
whsaataiyclmgsgqllwdtvtgvdmal

SCOPe Domain Coordinates for d3k39l_:

Click to download the PDB-style file with coordinates for d3k39l_.
(The format of our PDB-style files is described here.)

Timeline for d3k39l_: