Class a: All alpha proteins [46456] (289 folds) |
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) |
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) |
Protein automated matches [190059] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187214] (173 PDB entries) |
Domain d3k22b_: 3k22 B: [178973] automated match to d1m2za_ complexed with jzr, jzs |
PDB Entry: 3k22 (more details), 2.1 Å
SCOPe Domain Sequences for d3k22b_:
Sequence, based on SEQRES records: (download)
>d3k22b_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tlpqltptlvslleviepevlyagydssvpdstwrimttlnmlggrqviaavkwakaipg frnlhlddqmtllqyswmylmafalgwrsyrqssanllcfapdliineqrmtlpgmydqc khmlyvsselhrlqvsyeeylcmktllllssvpkdglksqelfdeirmtyikelgkaivk regnssqnwqrfyqltklldsmhevvenllnycfqtfldktmsiefpemlaeiitnqipk ysngnikkllfhq
>d3k22b_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tlpqltptlvslleviepevlyagydssvpdstwrimttlnmlggrqviaavkwakaipg frnlhlddqmtllqyswmylmafalgwrsyrqsanllcfapdliineqrmtlpgmydqck hmlyvsselhrlqvsyeeylcmktllllssvpkdglksqelfdeirmtyikelgkaivkr ensqnwqrfyqltklldsmhevvenllnycfqtfldktmsiefpemlaeiitnqipkysn gnikkllfhq
Timeline for d3k22b_: