Lineage for d3k0ra_ (3k0r A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2073956Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2073957Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2073958Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2073959Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 2073974Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (113 PDB entries)
    Uniprot P05092
  8. 2074103Domain d3k0ra_: 3k0r A: [178942]
    automated match to d1ak4a_
    mutant

Details for d3k0ra_

PDB Entry: 3k0r (more details), 2.42 Å

PDB Description: cryogenic structure of cypa mutant arg55lys
PDB Compounds: (A:) cyclophilin a

SCOPe Domain Sequences for d3k0ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k0ra_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhkiipgfm
cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOPe Domain Coordinates for d3k0ra_:

Click to download the PDB-style file with coordinates for d3k0ra_.
(The format of our PDB-style files is described here.)

Timeline for d3k0ra_: