SCOPe 2.05: Domain d3k0pa_: 3k0p A:

Lineage for d3k0pa_ (3k0p A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein Cyclophilin (eukaryotic) [50893] (13 species)

7. Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (78 PDB entries)
   Uniprot P05092

8. Domain d3k0pa_: 3k0p A: [178940]
   automated match to d1ak4a_
   mutant

Details for d3k0pa_

PDB Entry: 3k0p, 1.65 Å

PDB Description: cryogenic structure of cypa mutant ser99thr

PDB Compounds: (A:) cyclophilin a

SCOPe Domain Sequences for d3k0pa_:

Sequence; same for both SEQRES and ATOM records:

>d3k0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
cqggdftrhngtggksiygekfedenfilkhtgpgiltmanagpntngsqffictaktew
ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgq

Timeline for d3k0pa_:

• d3k0pa_ first appeared in SCOPe 2.01
  
• d3k0pa_ appears in SCOPe 2.04
  
• d3k0pa_ appears in SCOPe 2.06
  
• d3k0pa_ appears in the current release, SCOPe 2.08