Lineage for d3jzaa_ (3jza A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1362829Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1363774Protein automated matches [190047] (16 species)
    not a true protein
  7. 1363812Species Human (Homo sapiens) [TaxId:9606] [186768] (113 PDB entries)
  8. 1363878Domain d3jzaa_: 3jza A: [178927]
    automated match to d2fola1
    complexed with po4

Details for d3jzaa_

PDB Entry: 3jza (more details), 1.8 Å

PDB Description: crystal structure of human rab1b in complex with the gef domain of drra/sidm from legionella pneumophila
PDB Compounds: (A:) Ras-related protein Rab-1B

SCOPe Domain Sequences for d3jzaa_:

Sequence, based on SEQRES records: (download)

>d3jzaa_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktiklqiwd
tagqerfrtitssyyrgahgiivvydvtdqesyanvkqwlqeidryasenvnkllvgnks
dlttkkvvdnttakefadslgipfletsaknatnveqafmtmaaeikkrm

Sequence, based on observed residues (ATOM records): (download)

>d3jzaa_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktiklqiwd
tagqerfrtitssyyrgahgiivvydvtdqesyanvkqwlqeidryasenvnkllvgnks
dlttkkvvdnttakefadslgipfletsnatnveqafmtmaaeikkrm

SCOPe Domain Coordinates for d3jzaa_:

Click to download the PDB-style file with coordinates for d3jzaa_.
(The format of our PDB-style files is described here.)

Timeline for d3jzaa_: