Lineage for d3jyif_ (3jyi F:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568471Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2568472Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2568473Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2569281Protein automated matches [190161] (27 species)
    not a true protein
  7. 2569346Species Escherichia coli [TaxId:562] [187306] (75 PDB entries)
  8. 2569446Domain d3jyif_: 3jyi F: [178926]
    automated match to d1axba_
    complexed with epe, po4; mutant

Details for d3jyif_

PDB Entry: 3jyi (more details), 2.7 Å

PDB Description: Structural and biochemical evidence that a TEM-1 {beta}-lactamase Asn170Gly active site mutant acts via substrate-assisted catalysis
PDB Compounds: (F:) Beta-lactamase TEM

SCOPe Domain Sequences for d3jyif_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jyif_ e.3.1.1 (F:) automated matches {Escherichia coli [TaxId: 562]}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelgeaipnderdttmpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

SCOPe Domain Coordinates for d3jyif_:

Click to download the PDB-style file with coordinates for d3jyif_.
(The format of our PDB-style files is described here.)

Timeline for d3jyif_: