SCOPe 2.06: Domain d3jyid_: 3jyi D:

Lineage for d3jyid_ (3jyi D:)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (23 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187306] (66 PDB entries)

8. Domain d3jyid_: 3jyi D: [178924]
   automated match to d1axba_
   complexed with epe, po4; mutant

Details for d3jyid_

PDB Entry: 3jyi, 2.7 Å

PDB Description: structural and biochemical evidence that a tem-1 {beta}-lactamase asn170gly active site mutant acts via substrate-assisted catalysis

PDB Compounds: (D:) Beta-lactamase TEM

SCOPe Domain Sequences for d3jyid_:

Sequence; same for both SEQRES and ATOM records:

>d3jyid_ e.3.1.1 (D:) automated matches {Escherichia coli [TaxId: 562]}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelgeaipnderdttmpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

Timeline for d3jyid_:

• d3jyid_ first appeared in SCOPe 2.01
  
• d3jyid_ appears in SCOPe 2.05
  
• d3jyid_ appears in SCOPe 2.07
  
• d3jyid_ appears in the current release, SCOPe 2.08