Class b: All beta proteins [48724] (177 folds) |
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) single sheet; 10 strands |
Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) |
Family b.74.1.0: automated matches [191576] (1 protein) not a true family |
Protein automated matches [191011] (13 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188766] (12 PDB entries) |
Domain d3jxfa_: 3jxf A: [178906] Other proteins in same PDB: d3jxfb2 automated match to d1jcza_ |
PDB Entry: 3jxf (more details), 2 Å
SCOPe Domain Sequences for d3jxfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jxfa_ b.74.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} eeigwsytgalnqknwgkkyptcnspkqspinidedltqvnvnlkklkfqgwdktslent fihntgktveinltndyrvsggvsemvfkaskitfhwgkcnmssdgsehslegqkfplem qiycfdadrfssfeeavkgkgklralsilfevgteenldfkaiidgvesvsrfgkqaald pfillnllpnstdkyyiyngsltsppctdtvdwivfkdtvsisesqlavfcevltmqqsg yvmlmdylqnnfreqqykfsrqvfssyt
Timeline for d3jxfa_: