Lineage for d3jxfa_ (3jxf A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2077896Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2077897Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2078811Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 2078812Protein automated matches [191011] (13 species)
    not a true protein
  7. 2078893Species Human (Homo sapiens) [TaxId:9606] [188766] (12 PDB entries)
  8. 2078895Domain d3jxfa_: 3jxf A: [178906]
    Other proteins in same PDB: d3jxfb2
    automated match to d1jcza_

Details for d3jxfa_

PDB Entry: 3jxf (more details), 2 Å

PDB Description: ca-like domain of human ptprz
PDB Compounds: (A:) Receptor-type tyrosine-protein phosphatase zeta

SCOPe Domain Sequences for d3jxfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jxfa_ b.74.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eeigwsytgalnqknwgkkyptcnspkqspinidedltqvnvnlkklkfqgwdktslent
fihntgktveinltndyrvsggvsemvfkaskitfhwgkcnmssdgsehslegqkfplem
qiycfdadrfssfeeavkgkgklralsilfevgteenldfkaiidgvesvsrfgkqaald
pfillnllpnstdkyyiyngsltsppctdtvdwivfkdtvsisesqlavfcevltmqqsg
yvmlmdylqnnfreqqykfsrqvfssyt

SCOPe Domain Coordinates for d3jxfa_:

Click to download the PDB-style file with coordinates for d3jxfa_.
(The format of our PDB-style files is described here.)

Timeline for d3jxfa_: