SCOPe 2.03: Domain d3jx7a_: 3jx7 A:

Lineage for d3jx7a_ (3jx7 A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (24 families)

5. Family a.118.1.0: automated matches [191340] (1 protein)
   not a true family

6. Protein automated matches [190220] (5 species)
   not a true protein

7. Species Bacillus cereus [TaxId:222523] [189468] (4 PDB entries)

8. Domain d3jx7a_: 3jx7 A: [178899]
   automated match to d2b6ca1
   protein/DNA complex

Details for d3jx7a_

PDB Entry: 3jx7, 1.6 Å

PDB Description: bacillus cereus alkylpurine dna glycosylase alkd bound to dna containing a 3-methyladenine analog

PDB Compounds: (A:) Alkylpurine DNA Glycosylase AlkD

SCOPe Domain Sequences for d3jx7a_:

Sequence; same for both SEQRES and ATOM records:

>d3jx7a_ a.118.1.0 (A:) automated matches {Bacillus cereus [TaxId: 222523]}
pmhpfvkalqehftahqnpekaepmarymknhflflgiqtperrqllkdiiqihtlpdqk
dfqiiirelwdlperefqaaaldimqkykkhinethipfleelivtkswwdsvdsivptf
lgdiflkhpelisayipkwiasdniwlqraailfqlkykqkmdeellfwiigqlhsskef
fiqkaigwvlreyaktnpdvvweyvqnnelaplskreaikhikqnyginnek

Timeline for d3jx7a_:

• d3jx7a_ first appeared in SCOPe 2.01
  
• d3jx7a_ appears in SCOPe 2.02
  
• d3jx7a_ appears in SCOPe 2.04
  
• d3jx7a_ appears in the current release, SCOPe 2.08, called d3jx7a1