Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (23 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [188287] (13 PDB entries) |
Domain d3jvgd_: 3jvg D: [178845] Other proteins in same PDB: d3jvga1, d3jvgb1 automated match to d1a1mb_ complexed with cl, nag, unl |
PDB Entry: 3jvg (more details), 2.2 Å
SCOPe Domain Sequences for d3jvgd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jvgd_ b.1.1.0 (D:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} dltpkvqvysrfpasagtknvlncfaagfhppkisitlmkdgvpmegaqysdmsfnddwt fqrlvhadftpssgstyackvehetlkepqvykwdpef
Timeline for d3jvgd_: