Class a: All alpha proteins [46456] (286 folds) |
Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (26 families) |
Family a.118.1.0: automated matches [191340] (1 protein) not a true family |
Protein automated matches [190220] (12 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189070] (29 PDB entries) |
Domain d3juia_: 3jui A: [178836] automated match to d1paqa_ complexed with gol |
PDB Entry: 3jui (more details), 2 Å
SCOPe Domain Sequences for d3juia_:
Sequence, based on SEQRES records: (download)
>d3juia_ a.118.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ghhhhhhmddikvfqnevlgtlqrgkeeniscdnlvleinslkyaynislkevmqvlshv vlefplqqmdspldssrycalllpllkawspvfrnyikraadhlealaaiedffleheal gismakvlmafyqleilagetilswfsqrdttdkgqqlrknqqlqrfiqwlkeaee
>d3juia_ a.118.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ghhhhhhmddikvfqnevlgtlqrgkeeniscdnlvleinslkyaynislkevmqvlshv vlefplqqmdspldssrycalllpllkawspvfrnyikraadhlealaaiedffleheal gismakvlmafyqleilagetilswfsqrddkgqqlrknqqlqrfiqwlkeaee
Timeline for d3juia_: