![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein automated matches [191280] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189896] (32 PDB entries) |
![]() | Domain d3jtcb_: 3jtc B: [178820] Other proteins in same PDB: d3jtcc_, d3jtcd_ automated match to d1lqvb_ complexed with ca, mg, nag, ndg, pty |
PDB Entry: 3jtc (more details), 1.6 Å
SCOPe Domain Sequences for d3jtcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jtcb_ d.19.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lqrlhmlqisyfrdpyhvwyqgnaslgghlthvlegpdtnttiiqlqplqepeswartqs glqsyllqfhglvrlvhqertlafpltircflgcelppegsrahvffevavngssfvsfr peralwqadtqvtsgvvtftlqqlnaynrtryelrefledtcvqyvqkhisae
Timeline for d3jtcb_: