SCOPe 2.07: Domain d3jtca_: 3jtc A:

Lineage for d3jtca_ (3jtc A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein automated matches [191280] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189896] (33 PDB entries)

8. Domain d3jtca_: 3jtc A: [178819]
   Other proteins in same PDB: d3jtcc_, d3jtcd_
   automated match to d1lqvb_
   complexed with ca, mg, nag, ndg, pty

Details for d3jtca_

PDB Entry: 3jtc, 1.6 Å

PDB Description: importance of mg2+ in the ca2+-dependent folding of the gamma- carboxyglutamic acid domains of vitamin k-dependent clotting and anticlotting proteins

PDB Compounds: (A:) Endothelial protein C receptor

SCOPe Domain Sequences for d3jtca_:

Sequence; same for both SEQRES and ATOM records:

>d3jtca_ d.19.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glqrlhmlqisyfrdpyhvwyqgnaslgghlthvlegpdtnttiiqlqplqepeswartq
sglqsyllqfhglvrlvhqertlafpltircflgcelppegsrahvffevavngssfvsf
rperalwqadtqvtsgvvtftlqqlnaynrtryelrefledtcvqyvqkhis

Timeline for d3jtca_:

• d3jtca_ first appeared in SCOPe 2.01
  
• d3jtca_ appears in SCOPe 2.06
  
• d3jtca_ appears in the current release, SCOPe 2.08