SCOPe 2.08: Domain d3jt2b_: 3jt2 B:

Lineage for d3jt2b_ (3jt2 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein automated matches [190545] (9 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [187720] (5 PDB entries)

8. Domain d3jt2b_: 3jt2 B: [178798]
   automated match to d1bexa_
   complexed with cu

Details for d3jt2b_

PDB Entry: 3jt2, 2.1 Å

PDB Description: cu(ii) n47s/m121l variant of pseudomonas aeruginosa azurin

PDB Compounds: (B:) Azurin

SCOPe Domain Sequences for d3jt2b_:

Sequence; same for both SEQRES and ATOM records:

>d3jt2b_ b.6.1.1 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghswvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
lkgtltlk

Timeline for d3jt2b_:

• d3jt2b_ first appeared in SCOPe 2.01
  
• d3jt2b_ appears in SCOPe 2.07