Lineage for d3jsva_ (3jsv A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1194674Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1194675Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1194676Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1195091Protein automated matches [190118] (8 species)
    not a true protein
  7. 1195101Species Human (Homo sapiens) [TaxId:9606] [189560] (37 PDB entries)
  8. 1195163Domain d3jsva_: 3jsv A: [178793]
    Other proteins in same PDB: d3jsvb_
    automated match to d1aara_

Details for d3jsva_

PDB Entry: 3jsv (more details), 2.7 Å

PDB Description: crystal structure of mouse nemo cozi in complex with lys63-linked di- ubiquitin
PDB Compounds: (A:) Ubiquitin

SCOPe Domain Sequences for d3jsva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jsva_ d.15.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
iqrestlhlvlrlrgg

SCOPe Domain Coordinates for d3jsva_:

Click to download the PDB-style file with coordinates for d3jsva_.
(The format of our PDB-style files is described here.)

Timeline for d3jsva_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3jsvb_