Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families) has a circularly permuted topology |
Family d.142.2.2: Adenylation domain of NAD+-dependent DNA ligase [56096] (2 proteins) automatically mapped to Pfam PF01653 |
Protein Adenylation domain of NAD+-dependent DNA ligase [56097] (4 species) contains additional, N-terminal all-alpha subdomain |
Species Staphylococcus aureus [TaxId:1280] [189155] (2 PDB entries) |
Domain d3jsla_: 3jsl A: [178787] automated match to d1b04a_ complexed with so4 |
PDB Entry: 3jsl (more details), 1.8 Å
SCOPe Domain Sequences for d3jsla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jsla_ d.142.2.2 (A:) Adenylation domain of NAD+-dependent DNA ligase {Staphylococcus aureus [TaxId: 1280]} adlssrvnelhdllnqysyeyyvednpsvpdseydkllhelikieeehpeyktvdsptvr vggeaqasfnkvnhdtpmlslgnafneddlrkfdqrireqignveymcelkidglavslk yvdgyfvqgltrgdgttgeditenlktihaiplkmkeplnvevrgeaymprrsflrlnee kekndeqlfanprnaaagslrqldskltakrklsvfiysvndftdfnarsqsealdeldk lgfttnknrarvnnidgvleyiekwtsqreslpydidgivikvndldqqdemgftqkspr waiaykfp
Timeline for d3jsla_: