Lineage for d3jseo_ (3jse O:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700032Superfamily a.24.8: Proteasome activator [47216] (1 family) (S)
  5. 2700033Family a.24.8.1: Proteasome activator [47217] (3 proteins)
  6. 2700046Protein automated matches [190828] (1 species)
    not a true protein
  7. 2700047Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [188131] (7 PDB entries)
  8. 2700089Domain d3jseo_: 3jse O: [178772]
    Other proteins in same PDB: d3jsea_, d3jseb_, d3jsec_, d3jsed_, d3jsee_, d3jsef_, d3jseg_, d3jseh_, d3jsei_, d3jsej_, d3jsek_, d3jsel_, d3jsem_, d3jsen_
    automated match to d1ya7o1

Details for d3jseo_

PDB Entry: 3jse (more details), 2.9 Å

PDB Description: crystal structure of archaeal 20s proteasome in complex with mutated p26 activator
PDB Compounds: (O:) proteasome activator protein PA26

SCOPe Domain Sequences for d3jseo_:

Sequence, based on SEQRES records: (download)

>d3jseo_ a.24.8.1 (O:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
tlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspslllel
rqidadfmlkvelatthlstmvravinayllnwkkliqprtgtdhmfs

Sequence, based on observed residues (ATOM records): (download)

>d3jseo_ a.24.8.1 (O:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
velatthlstmvravinayllnwkkliqprtgtdhmfs

SCOPe Domain Coordinates for d3jseo_:

Click to download the PDB-style file with coordinates for d3jseo_.
(The format of our PDB-style files is described here.)

Timeline for d3jseo_: