Lineage for d3jsen_ (3jse N:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2226421Protein Proteasome beta subunit (catalytic) [56252] (6 species)
  7. 2228337Species Thermoplasma acidophilum [TaxId:2303] [56253] (5 PDB entries)
  8. 2228351Domain d3jsen_: 3jse N: [178771]
    Other proteins in same PDB: d3jsea_, d3jseb_, d3jsec_, d3jsed_, d3jsee_, d3jsef_, d3jseg_, d3jseo_, d3jsep_, d3jseq_, d3jser_, d3jses_, d3jset_, d3jseu_
    automated match to d1pma1_

Details for d3jsen_

PDB Entry: 3jse (more details), 2.9 Å

PDB Description: crystal structure of archaeal 20s proteasome in complex with mutated p26 activator
PDB Compounds: (N:) Proteasome subunit beta

SCOPe Domain Sequences for d3jsen_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jsen_ d.153.1.4 (N:) Proteasome beta subunit (catalytic) {Thermoplasma acidophilum [TaxId: 2303]}
tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
kdgyvqlptdqiesrirklglil

SCOPe Domain Coordinates for d3jsen_:

Click to download the PDB-style file with coordinates for d3jsen_.
(The format of our PDB-style files is described here.)

Timeline for d3jsen_: