Lineage for d3jrmp_ (3jrm P:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988268Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1988712Superfamily a.24.8: Proteasome activator [47216] (1 family) (S)
  5. 1988713Family a.24.8.1: Proteasome activator [47217] (3 proteins)
  6. 1988726Protein automated matches [190828] (1 species)
    not a true protein
  7. 1988727Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [188131] (5 PDB entries)
  8. 1988749Domain d3jrmp_: 3jrm P: [178739]
    Other proteins in same PDB: d3jrma_, d3jrmb_, d3jrmc_, d3jrmd_, d3jrme_, d3jrmf_, d3jrmg_, d3jrmh_, d3jrmi_, d3jrmj_, d3jrmk_, d3jrml_, d3jrmm_, d3jrmn_
    automated match to d1ya7o1

Details for d3jrmp_

PDB Entry: 3jrm (more details), 2.9 Å

PDB Description: crystal structure of archaeal 20s proteasome in complex with mutated p26 activator
PDB Compounds: (P:) proteasome activator protein PA26

SCOPe Domain Sequences for d3jrmp_:

Sequence, based on SEQRES records: (download)

>d3jrmp_ a.24.8.1 (P:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
peqllgvlqryqdlchnvycqaetirtviairipehkeadnlgvavqhavlkiideleik
tlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspslllel
rqidadfmlkvelatthlstmvravinayllnwkkliqprtgtdhmys

Sequence, based on observed residues (ATOM records): (download)

>d3jrmp_ a.24.8.1 (P:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
peqllgvlqryqdlchnvycqaetirtviairipehkeadnlgvavqhavlkiideleik
tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
velatthlstmvravinayllnwkkliqprtgtdhmys

SCOPe Domain Coordinates for d3jrmp_:

Click to download the PDB-style file with coordinates for d3jrmp_.
(The format of our PDB-style files is described here.)

Timeline for d3jrmp_: