Lineage for d3jrml_ (3jrm L:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1044569Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1044570Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1044729Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1045208Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 1045593Species Thermoplasma acidophilum [TaxId:2303] [56253] (5 PDB entries)
  8. 1045598Domain d3jrml_: 3jrm L: [178735]
    Other proteins in same PDB: d3jrma_, d3jrmb_, d3jrmc_, d3jrmd_, d3jrme_, d3jrmf_, d3jrmg_, d3jrmo_, d3jrmp_, d3jrmq_, d3jrmr_, d3jrms_, d3jrmt_, d3jrmu_
    automated match to d1pma1_

Details for d3jrml_

PDB Entry: 3jrm (more details), 2.9 Å

PDB Description: crystal structure of archaeal 20s proteasome in complex with mutated p26 activator
PDB Compounds: (L:) Proteasome subunit beta

SCOPe Domain Sequences for d3jrml_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jrml_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Thermoplasma acidophilum [TaxId: 2303]}
tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
kdgyvqlptdqiesrirklglil

SCOPe Domain Coordinates for d3jrml_:

Click to download the PDB-style file with coordinates for d3jrml_.
(The format of our PDB-style files is described here.)

Timeline for d3jrml_: