Lineage for d3jrmc_ (3jrm C:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1222614Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1222615Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1222781Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1223777Protein automated matches [190144] (8 species)
    not a true protein
  7. 1224185Species Thermoplasma acidophilum [TaxId:2303] [186869] (5 PDB entries)
  8. 1224230Domain d3jrmc_: 3jrm C: [178726]
    Other proteins in same PDB: d3jrmh_, d3jrmi_, d3jrmj_, d3jrmk_, d3jrml_, d3jrmm_, d3jrmn_, d3jrmo_, d3jrmp_, d3jrmq_, d3jrmr_, d3jrms_, d3jrmt_, d3jrmu_
    automated match to d1pmaa_

Details for d3jrmc_

PDB Entry: 3jrm (more details), 2.9 Å

PDB Description: crystal structure of archaeal 20s proteasome in complex with mutated p26 activator
PDB Compounds: (C:) Proteasome subunit alpha

SCOPe Domain Sequences for d3jrmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jrmc_ d.153.1.4 (C:) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
aydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiek
iqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqy
ggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpe
keavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl

SCOPe Domain Coordinates for d3jrmc_:

Click to download the PDB-style file with coordinates for d3jrmc_.
(The format of our PDB-style files is described here.)

Timeline for d3jrmc_: