SCOPe 2.06: Domain d3jqwb_: 3jqw B:

Lineage for d3jqwb_ (3jqw B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.0: automated matches [191481] (1 protein)
   not a true family

6. Protein automated matches [190770] (37 species)
   not a true protein

7. Species Clostridium histolyticum [TaxId:1498] [267692] (2 PDB entries)

8. Domain d3jqwb_: 3jqw B: [178708]
   Other proteins in same PDB: d3jqwc2
   automated match to d1nqda_
   complexed with ca

Details for d3jqwb_

PDB Entry: 3jqw, 2 Å

PDB Description: Crystal structure of Clostridium histolyticum colH collagenase collagen-binding domain 3 at 2 Angstrom resolution in presence of calcium

PDB Compounds: (B:) ColH protein

SCOPe Domain Sequences for d3jqwb_:

Sequence; same for both SEQRES and ATOM records:

>d3jqwb_ b.18.1.0 (B:) automated matches {Clostridium histolyticum [TaxId: 1498]}
vypigtekepnnsketasgpivpgipvsgtientsdqdyfyfdvitpgevkidinklgyg
gatwvvydennnavsyatddgqnlsgkfkadkpgryyihlymfngsympyriniegsvgr

Timeline for d3jqwb_:

• d3jqwb_ first appeared in SCOPe 2.01
  
• d3jqwb_ appears in SCOPe 2.05
  
• d3jqwb_ appears in SCOPe 2.07
  
• d3jqwb_ appears in the current release, SCOPe 2.08