Class a: All alpha proteins [46456] (284 folds) |
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) |
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) |
Protein automated matches [190059] (12 species) not a true protein |
Species Cotton bollworm (Helicoverpa armigera) [TaxId:29058] [189564] (1 PDB entry) |
Domain d3ixpd_: 3ixp D: [178681] Other proteins in same PDB: d3ixpa_ automated match to d1r20d_ complexed with 834, eph |
PDB Entry: 3ixp (more details), 2.85 Å
SCOPe Domain Sequences for d3ixpd_:
Sequence, based on SEQRES records: (download)
>d3ixpd_ a.123.1.1 (D:) automated matches {Cotton bollworm (Helicoverpa armigera) [TaxId: 29058]} vppltanqksliarlvyyqegyeqpseedlkrvtqtwqsdeddedsdmpfrqitemtilt vqlivefakglpgfskisqsdqitllkacssevmmlrvarrydaatdsvlfannqaytrd nyrkagmayviedllhfcrcmysmmmdnvhyalltaivifsdrpgleqpslveeiqryyl ntlrvyilnqnsasprsavifgkilgilteirtlgmqnsnmcislklknrklppfleeiw dva
>d3ixpd_ a.123.1.1 (D:) automated matches {Cotton bollworm (Helicoverpa armigera) [TaxId: 29058]} vppltanqksliarlvyyqegyeqmpfrqitemtiltvqlivefakglpgfskisqsdqi tllkacssevmmlrvarrydaatdsvlfannqaytrdnyrkagmayviedllhfcrcmys mmmdnvhyalltaivifsdrpgleqpslveeiqryylntlrvyilnqnsasprsavifgk ilgilteirtlgmqnsnmcislklknrklppfleeiwdva
Timeline for d3ixpd_: