SCOPe 2.08: Domain d3ixfa_: 3ixf A:

Lineage for d3ixfa_ (3ixf A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (43 species)
   not a true protein

7. Species Amphitrite ornata [TaxId:129555] [189339] (47 PDB entries)

8. Domain d3ixfa_: 3ixf A: [178667]
   automated match to d1ew6a_
   complexed with hem, oxy, so4

Details for d3ixfa_

PDB Entry: 3ixf, 1.58 Å

PDB Description: Crystal Structure of Dehaloperoxidase B at 1.58 and Structural Characterization of the AB Dimer from Amphitrite ornata

PDB Compounds: (A:) Dehaloperoxidase B

SCOPe Domain Sequences for d3ixfa_:

Sequence; same for both SEQRES and ATOM records:

>d3ixfa_ a.1.1.2 (A:) automated matches {Amphitrite ornata [TaxId: 129555]}
gfkqdiatlrgdlrtyaqdiflaflnkypdekrnfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdastlvqmkqhsglttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

Timeline for d3ixfa_:

• d3ixfa_ first appeared in SCOPe 2.01
  
• d3ixfa_ appears in SCOPe 2.07