SCOPe 2.01: Domain d3ivga_: 3ivg A:

Lineage for d3ivga_ (3ivg A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.4: Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63976] (2 proteins)
   contains C-terminal subdomain similar to one structural repeat of the Creatinase/aminopeptidase family

6. Protein automated matches [191096] (3 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [189078] (13 PDB entries)

8. Domain d3ivga_: 3ivg A: [178627]
   automated match to d1n2ga_
   complexed with edo, eoh, fg5, gol

Details for d3ivga_

PDB Entry: 3ivg, 1.95 Å

PDB Description: crystal structure of pantothenate synthetase in complex with 2-(2- ((benzofuran-2-sulfonamido)methyl)-5-methoxy-1h-indol-1-yl)acetic acid

PDB Compounds: (A:) Pantothenate synthetase

SCOPe Domain Sequences for d3ivga_:

Sequence; same for both SEQRES and ATOM records:

>d3ivga_ c.26.1.4 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
ipafhpgelnvysapgdvadvsralrltgrrvmlvptmgalheghlalvraakrvpgsvv
vvsifvnpmqfgaggdldayprtpdddlaqlraegveiaftpttaamypdglrttvqpgp
laaeleggprpthfagvltvvlkllqivrpdrvffgekdyqqlvlirqlvadfnldvavv
gvptvreadglamssrnryldpaqraaavalsaaltaaahaatagaqaaldaaravldaa
pgvavdylelrdiglgpmplngsgrllvaarlgttrlldniaieigt

Timeline for d3ivga_:

• d3ivga_ is new in SCOPe 2.01-stable
  
• d3ivga_ appears in SCOPe 2.02
  
• d3ivga_ appears in the current release, SCOPe 2.08