Lineage for d3irtb_ (3irt B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1191813Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1191814Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1192305Family d.3.1.6: Ubiquitin carboxyl-terminal hydrolase UCH-L [54050] (3 proteins)
  6. 1192319Protein automated matches [191161] (1 species)
    not a true protein
  7. 1192320Species Human (Homo sapiens) [TaxId:9606] [189359] (4 PDB entries)
  8. 1192323Domain d3irtb_: 3irt B: [178584]
    automated match to d2etla1
    complexed with cl; mutant

Details for d3irtb_

PDB Entry: 3irt (more details), 2.8 Å

PDB Description: Crystal Structure of the I93M Mutant of Ubiquitin Carboxy-terminal Hydrolase L1
PDB Compounds: (B:) Ubiquitin carboxyl-terminal hydrolase isozyme L1

SCOPe Domain Sequences for d3irtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3irtb_ d.3.1.6 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqlkpmeinpemlnkvlsrlgvagqwrfvdvlgleeeslgsvpapacallllfpltaqhe
nfrkkqieelkgqevspkvyfmkqtignscgtmglihavannqdklgfedgsvlkqflse
tekmspedrakcfekneaiqaahdavaqegqcrvddkvnfhfilfnnvdghlyeldgrmp
fpvnhgassedtllkdaakvcreftereqgevrfsavalckaa

SCOPe Domain Coordinates for d3irtb_:

Click to download the PDB-style file with coordinates for d3irtb_.
(The format of our PDB-style files is described here.)

Timeline for d3irtb_: