SCOPe 2.08: Domain d3ir8b_: 3ir8 B:

Lineage for d3ir8b_ (3ir8 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (19 species)
   not a true protein

7. Species Montipora sp. [TaxId:321802] [189025] (4 PDB entries)

8. Domain d3ir8b_: 3ir8 B: [178579]
   automated match to d1moua_

Details for d3ir8b_

PDB Entry: 3ir8, 1.63 Å

PDB Description: red fluorescent protein mkeima at ph 7.0

PDB Compounds: (B:) Large stokes shift fluorescent protein

SCOPe Domain Sequences for d3ir8b_:

Sequence; same for both SEQRES and ATOM records:

>d3ir8b_ d.22.1.1 (B:) automated matches {Montipora sp. [TaxId: 321802]}
sviakqmtykvymsgtvnghyfevegdgkgkpyegeqtvkltvtkggplpfawdilspql
qygsipftkypedipdyfkqsfpegytwersmnfedgavctvsndssiqgncfiynvkis
genfppngpvmqkktqgwepsterlfardgmligndymalkleggghylcefkstykakk
pvrmpgrheidrkldvtshnrdytsveqceiaiarhs

Timeline for d3ir8b_:

• d3ir8b_ first appeared in SCOPe 2.01
  
• d3ir8b_ appears in SCOPe 2.07