Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) |
Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other |
Protein Respiratory nitrate reductase 1 beta chain [102955] (2 species) |
Species Escherichia coli K-12 [TaxId:83333] [189178] (3 PDB entries) |
Domain d3ir7b_: 3ir7 B: [178576] Other proteins in same PDB: d3ir7a1, d3ir7a2, d3ir7c_ automated match to d1q16b_ complexed with 6mo, aga, f3s, hem, md1, sf4; mutant |
PDB Entry: 3ir7 (more details), 2.5 Å
SCOPe Domain Sequences for d3ir7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ir7b_ d.58.1.5 (B:) Respiratory nitrate reductase 1 beta chain {Escherichia coli K-12 [TaxId: 83333]} mkirsqvgmvlnldkcigchtcsvtcknvwtsregveyawfnnvetkpgqgfptdwenqe kykggwirkingklqprmgnramllgkifanphlpgiddyyepfdfdyqnlhtapegsks qpiarprslitgermakiekgpnweddlggefdklakdknfdniqkamysqfentfmmyl prlcehclnpacvatcpsgaiykreedgivlidqdkcrgwrmcitgcpykkiyfnwksgk sekcifcyprieagqptvcsetcvgrirylgvllydadaieraastenekdlyqrqldvf ldpndpkvieqaikdgiplsvieaaqqspvykmamewklalplhpeyrtlpmvwyvppls piqsaadagelgsngilpdveslripvqylanlltagdtkpvlralkrmlamrhykraet vdgkvdtraleevglteaqaqemyrylaianyedrfvvpsshrelareafpekngcgftf gdgchgsdtkfnlfnsrridaidvtskte
Timeline for d3ir7b_: