Lineage for d3ir7b_ (3ir7 B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1650134Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 1650266Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 1650393Protein Respiratory nitrate reductase 1 beta chain [102955] (2 species)
  7. 1650394Species Escherichia coli K-12 [TaxId:83333] [189178] (3 PDB entries)
  8. 1650396Domain d3ir7b_: 3ir7 B: [178576]
    Other proteins in same PDB: d3ir7a1, d3ir7a2, d3ir7c_
    automated match to d1q16b_
    complexed with 6mo, aga, f3s, hem, md1, sf4; mutant

Details for d3ir7b_

PDB Entry: 3ir7 (more details), 2.5 Å

PDB Description: crystal structure of narghi mutant narg-r94s
PDB Compounds: (B:) Respiratory nitrate reductase 1 beta chain

SCOPe Domain Sequences for d3ir7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ir7b_ d.58.1.5 (B:) Respiratory nitrate reductase 1 beta chain {Escherichia coli K-12 [TaxId: 83333]}
mkirsqvgmvlnldkcigchtcsvtcknvwtsregveyawfnnvetkpgqgfptdwenqe
kykggwirkingklqprmgnramllgkifanphlpgiddyyepfdfdyqnlhtapegsks
qpiarprslitgermakiekgpnweddlggefdklakdknfdniqkamysqfentfmmyl
prlcehclnpacvatcpsgaiykreedgivlidqdkcrgwrmcitgcpykkiyfnwksgk
sekcifcyprieagqptvcsetcvgrirylgvllydadaieraastenekdlyqrqldvf
ldpndpkvieqaikdgiplsvieaaqqspvykmamewklalplhpeyrtlpmvwyvppls
piqsaadagelgsngilpdveslripvqylanlltagdtkpvlralkrmlamrhykraet
vdgkvdtraleevglteaqaqemyrylaianyedrfvvpsshrelareafpekngcgftf
gdgchgsdtkfnlfnsrridaidvtskte

SCOPe Domain Coordinates for d3ir7b_:

Click to download the PDB-style file with coordinates for d3ir7b_.
(The format of our PDB-style files is described here.)

Timeline for d3ir7b_: