Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.3: Respiratory nitrate reductase 1 gamma chain [103501] (1 family) possible link between the two other superfamilies: this subunit corresponds to the gamma subunit of a functionally related Formate dehydrogenase N complex but is structurally closer to the Fumarate reductase subunit FrdC automatically mapped to Pfam PF02665 |
Family f.21.3.1: Respiratory nitrate reductase 1 gamma chain [103502] (2 proteins) |
Protein automated matches [191115] (1 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [189179] (4 PDB entries) |
Domain d3ir5c_: 3ir5 C: [178573] Other proteins in same PDB: d3ir5a1, d3ir5a2, d3ir5b_ automated match to d1q16c_ complexed with 6mo, aga, f3s, hem, md1, sf4; mutant |
PDB Entry: 3ir5 (more details), 2.3 Å
SCOPe Domain Sequences for d3ir5c_:
Sequence, based on SEQRES records: (download)
>d3ir5c_ f.21.3.1 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]} mqflnmfffdiypyiagavfligswlrydygqytwraassqmldrkgmnlasnlfhigil gifvghffgmltphwmyeawlpievkqkmamfaggasgvlcliggvlllkrrlfsprvra tttgadililsllviqcalglltipfsaqhmdgsemmklvgwaqsvvtfhggasqhldgv afifrlhlvlgmtlfllfpfsrlihiwsvpveyltrkyqlvrarh
>d3ir5c_ f.21.3.1 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]} mqflnmfffdiypyiagavfligswlrydygqytwraassqmldrkgmnlasnlfhigil gifvghffgmlteawlpievkqkmamfaggasgvlcliggvlllkrrlfsprvratttga dililsllviqcalglltipfsaqhmdgsemmklvgwaqsvvtfhggasqhldgvafifr lhlvlgmtlfllfpfsrlihiwsvpveyltrkyqlvrarh
Timeline for d3ir5c_: