Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) |
Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins) |
Protein automated matches [190054] (13 species) not a true protein |
Species Haemophilus influenzae [TaxId:727] [189119] (3 PDB entries) |
Domain d3iqhx_: 3iqh X: [178555] automated match to d1y7la1 complexed with so4 |
PDB Entry: 3iqh (more details), 1.9 Å
SCOPe Domain Sequences for d3iqhx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iqhx_ c.79.1.1 (X:) automated matches {Haemophilus influenzae [TaxId: 727]} aiyadnsysigntplvrlkhfghngnvvvkiegrnpsysvkcriganmvwqaekdgtltk gkeivdatsgntgialayvaaargykitltmpetmslerkrllcglgvnlvltegakgmk gaiakaeeivasdpsryvmlkqfenpanpqihrettgpeiwkdtdgkvdvvvagvgtggs itgisraikldfgkqitsvavepvespvisqtlageevkpgphkiqgigagfipknldls iidrvetvdsdtalatarrlmaeegilagissgaavaaadrlaklpefadklivvilpsa serylstalf
Timeline for d3iqhx_: