SCOPe 2.04: Domain d3in7c_: 3in7 C:

Lineage for d3in7c_ (3in7 C:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein Growth factor receptor-bound protein 2 (GRB2) [55563] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55564] (34 PDB entries)

8. Domain d3in7c_: 3in7 C: [178438]
   automated match to d1fhsa_
   complexed with ayq

Details for d3in7c_

PDB Entry: 3in7, 2 Å

PDB Description: crystal structure of the grb2 sh2 domain in complex with a cyclopropyl-constrained ac-py-q-n-nh2 tripeptide mimic

PDB Compounds: (C:) Growth factor receptor-bound protein 2

SCOPe Domain Sequences for d3in7c_:

Sequence; same for both SEQRES and ATOM records:

>d3in7c_ d.93.1.1 (C:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]}
mkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdg
agkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqv

Timeline for d3in7c_:

• d3in7c_ first appeared in SCOPe 2.01
  
• d3in7c_ appears in SCOPe 2.03
  
• d3in7c_ appears in SCOPe 2.05
  
• d3in7c_ appears in the current release, SCOPe 2.08