Lineage for d3imca_ (3imc A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 984755Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 984756Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 985152Family c.26.1.4: Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63976] (2 proteins)
    contains C-terminal subdomain similar to one structural repeat of the Creatinase/aminopeptidase family
  6. 985199Protein automated matches [191096] (3 species)
    not a true protein
  7. 985200Species Mycobacterium tuberculosis [TaxId:1773] [189078] (13 PDB entries)
  8. 985203Domain d3imca_: 3imc A: [178400]
    automated match to d1n2ga_
    complexed with bz3, eoh, gol, so4

Details for d3imca_

PDB Entry: 3imc (more details), 1.6 Å

PDB Description: crystal structure of mycobacterium tuberculosis pantothenate synthetase at 1.6 ang resolution in complex with fragment compound 5- methoxyindole, sulfate and glycerol
PDB Compounds: (A:) Pantothenate synthetase

SCOPe Domain Sequences for d3imca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3imca_ c.26.1.4 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
pafhpgelnvysapgdvadvsralrltgrrvmlvptmgalheghlalvraakrvpgsvvv
vsifvnpmqfgaggdldayprtpdddlaqlraegveiaftpttaamypdglrttvqpgpl
aaeleggprpthfagvltvvlkllqivrpdrvffgekdyqqlvlirqlvadfnldvavvg
vptvreadglamssrnryldpaqraaavalsaaltaaahaatagaqaaldaaravldaap
gvavdylelrdiglgpmplngsgrllvaarlgttrlldniaieigtf

SCOPe Domain Coordinates for d3imca_:

Click to download the PDB-style file with coordinates for d3imca_.
(The format of our PDB-style files is described here.)

Timeline for d3imca_: