Lineage for d3ilwa_ (3ilw A:)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1056684Fold e.11: Type II DNA topoisomerase [56718] (1 superfamily)
    4 domains: (1) toprim alpha/beta; (2) "winged helix"-like; (3) alpha+beta; (4) all-alpha
  4. 1056685Superfamily e.11.1: Type II DNA topoisomerase [56719] (2 families) (S)
  5. 1056704Family e.11.1.0: automated matches [191600] (1 protein)
    not a true family
  6. 1056705Protein automated matches [191091] (1 species)
    not a true protein
  7. 1056706Species Mycobacterium tuberculosis [TaxId:1773] [189069] (1 PDB entry)
  8. 1056707Domain d3ilwa_: 3ilw A: [178390]
    automated match to d1ab4a_
    complexed with gol

Details for d3ilwa_

PDB Entry: 3ilw (more details), 1.6 Å

PDB Description: structure of dna gyrase subunit a n-terminal domain
PDB Compounds: (A:) DNA gyrase subunit A

SCOPe Domain Sequences for d3ilwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ilwa_ e.11.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
vgralpevrdglkpvhrrvlyamfdsgfrpdrshaksarsvaetmgnyhphgdasiydsl
vrmaqpwslryplvdgqgnfgspgndppaamrytearltplamemlreideetvdfipny
dgrvqeptvlpsrfpnllangsggiavgmatnipphnlreladavfwalenhdadeeetl
aavmgrvkgpdfptaglivgsqgtadayktgrgsirmrgvveveedsrgrtslvitelpy
qvnhdnfitsiaeqvrdgklagisniedqssdrvglrivieikrdavakvvinnlykhtq
lqtsfganmlaivdgvprtlrldqliryyvdhqldvivrrttyrlrkanerahilrglvk
aldaldevialirasetvdiaraglielldideiqaqaildmqlrrlaalerqriiddla
kieaeiadledilakperqrgivrdelaeivdrhgddrrtriia

SCOPe Domain Coordinates for d3ilwa_:

Click to download the PDB-style file with coordinates for d3ilwa_.
(The format of our PDB-style files is described here.)

Timeline for d3ilwa_: