Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.5: IpsF-like [69765] (2 families) forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
Family d.79.5.1: IpsF-like [69766] (3 proteins) automatically mapped to Pfam PF02542 |
Protein automated matches [190985] (6 species) not a true protein |
Species Burkholderia pseudomallei [TaxId:28450] [189021] (2 PDB entries) |
Domain d3ikeb_: 3ike B: [178370] automated match to d1jn1a_ complexed with cl, cyt, mg, zn |
PDB Entry: 3ike (more details), 2.3 Å
SCOPe Domain Sequences for d3ikeb_:
Sequence, based on SEQRES records: (download)
>d3ikeb_ d.79.5.1 (B:) automated matches {Burkholderia pseudomallei [TaxId: 28450]} mdfrigqgydvhqlvpgrpliiggvtipyergllghsdadvllhaitdalfgaaalgdig rhfsdtdprfkgadsrallrecasrvaqagfairnvdstiiaqapklaphidamraniaa dldlpldrvnvkaktneklgylgrgegieaqaaalvvr
>d3ikeb_ d.79.5.1 (B:) automated matches {Burkholderia pseudomallei [TaxId: 28450]} mdfrigqgydvhqlvpgrpliiggvtipyerglldadvllhaitdalfgaaalgdigrhf sdtdprfadsrallrecasrvaqagfairnvdstiiaqapklaphidamraniaadldlp ldrvnvkaktneklgylgrgegieaqaaalvvr
Timeline for d3ikeb_: