SCOPe 2.02: Domain d3ijtb_: 3ijt B:

Lineage for d3ijtb_ (3ijt B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.9: Smu440-like [160747] (1 protein)
   PfamB PB094079

6. Protein Hypothetical protein SMU440 [160748] (1 species)

7. Species Streptococcus mutans [TaxId:1309] [160749] (1 PDB entry)
   Uniprot Q8DVN6 1-137

8. Domain d3ijtb_: 3ijt B: [178351]
   automatically matched to 2B79 A:1-137

Details for d3ijtb_

PDB Entry: 3ijt, 2.38 Å

PDB Description: structural characterization of smu.440, a hypothetical protein from streptococcus mutans

PDB Compounds: (B:) Putative uncharacterized protein

SCOPe Domain Sequences for d3ijtb_:

Sequence; same for both SEQRES and ATOM records:

>d3ijtb_ d.129.3.9 (B:) Hypothetical protein SMU440 {Streptococcus mutans [TaxId: 1309]}
qmgrgsmkfsfelavntkkedawtyysqvnqwfvwegdleqislegefttgqkgkmkmed
mpelaftlvevrenqcfsdltatpfgnvlfeheilenpdgtislrhsvsltdsdtteeal
aflkqifadvpesvgklkqilet

Timeline for d3ijtb_:

• d3ijtb_ first appeared in SCOPe 2.01
  
• d3ijtb_ appears in SCOPe 2.03
  
• d3ijtb_ appears in the current release, SCOPe 2.08, called d3ijtb1