SCOPe 2.01: Domain d3ijta_: 3ijt A:

Lineage for d3ijta_ (3ijt A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.9: Smu440-like [160747] (1 protein)
   PfamB PB094079

6. Protein Hypothetical protein SMU440 [160748] (1 species)

7. Species Streptococcus mutans [TaxId:1309] [160749] (1 PDB entry)
   Uniprot Q8DVN6 1-137

8. Domain d3ijta_: 3ijt A: [178350]

Details for d3ijta_

PDB Entry: 3ijt, 2.38 Å

PDB Description: structural characterization of smu.440, a hypothetical protein from streptococcus mutans

PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d3ijta_:

Sequence; same for both SEQRES and ATOM records:

>d3ijta_ d.129.3.9 (A:) Hypothetical protein SMU440 {Streptococcus mutans [TaxId: 1309]}
rgsmkfsfelavntkkedawtyysqvnqwfvwegdleqislegefttgqkgkmkmedmpe
laftlvevrenqcfsdltatpfgnvlfeheilenpdgtislrhsvsltdsdtteealafl
kqifadvpesvgklkqilet

Timeline for d3ijta_:

• d3ijta_ is new in SCOPe 2.01-stable
  
• d3ijta_ appears in SCOPe 2.02
  
• d3ijta_ appears in the current release, SCOPe 2.08, called d3ijta1