Lineage for d3iepa_ (3iep A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2573817Fold e.23: Acetyl-CoA synthetase-like [56800] (1 superfamily)
    4 domains: (1&2) duplication: share the same alpha/beta fold; (3) beta-barrel; (4) alpha+beta
  4. 2573818Superfamily e.23.1: Acetyl-CoA synthetase-like [56801] (2 families) (S)
  5. 2573819Family e.23.1.1: Acetyl-CoA synthetase-like [56802] (7 proteins)
  6. 2573870Protein Luciferase [56803] (2 species)
  7. 2573871Species Firefly (Photinus pyralis) [TaxId:7054] [56804] (6 PDB entries)
  8. 2573877Domain d3iepa_: 3iep A: [178286]
    automated match to d1ba3a_

Details for d3iepa_

PDB Entry: 3iep (more details), 2.1 Å

PDB Description: firefly luciferase apo structure (p41 form)
PDB Compounds: (A:) Luciferin 4-monooxygenase

SCOPe Domain Sequences for d3iepa_:

Sequence, based on SEQRES records: (download)

>d3iepa_ e.23.1.1 (A:) Luciferase {Firefly (Photinus pyralis) [TaxId: 7054]}
daknikkgpapfypledgtageqlhkamkryalvpgtiaftdahievnityaeyfemsvr
laeamkryglntnhrivvcsenslqffmpvlgalfigvavapandiynerellnsmnisq
ptvvfvskkglqkilnvqkklpiiqkiiimdsktdyqgfqsmytfvtshlppgfneydfv
pesfdrdktialimnssgstglpkgvalphrtacvrfshardpifgnqiipdtailsvvp
fhhgfgmfttlgylicgfrvvlmyrfeeelflrslqdykiqsallvptlfsffakstlid
kydlsnlheiasggaplskevgeavakrfhlpgirqgygltettsailitpegddkpgav
gkvvpffeakvvdldtgktlgvnqrgelcvrgpmimsgyvnnpeatnalidkdgwlhsgd
iaywdedehffiv

Sequence, based on observed residues (ATOM records): (download)

>d3iepa_ e.23.1.1 (A:) Luciferase {Firefly (Photinus pyralis) [TaxId: 7054]}
daknikkgpapfypledgtageqlhkamkryalvpgtiaftdahievnityaeyfemsvr
laeamkryglntnhrivvcsenslqffmpvlgalfigvavapandiynerellnsmnisq
ptvvfvskkglqkilnvqkklpiiqkiiimdsktdyqgfqsmytfvtshlppgfneydfv
pesfdrdktialimnsslpkgvalphrtacvrfshardpifgnqiipdtailsvvpfhhg
fgmfttlgylicgfrvvlmyrfeeelflrslqdykiqsallvptlfsffakstlidkydl
snlheiasggaplskevgeavakrfhlpgirqgygltettsailitpegdkpgavgkvvp
ffeakvvdldtgktlgvnqrgelcvrgpmimsgyvnnpeatnalidkdgwlhsgdiaywd
edehffiv

SCOPe Domain Coordinates for d3iepa_:

Click to download the PDB-style file with coordinates for d3iepa_.
(The format of our PDB-style files is described here.)

Timeline for d3iepa_: